{"product_id":"proteintech-86394-1-rr","title":"Proteintech, 86394-1-RR, COQ7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe COQ7 (86394-1-RR) by Proteintech is a Recombinant antibody targeting COQ7 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86394-1-RR targets COQ7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HL-60 cells,  mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOQ7(Ubiquinone biosynthesis protein COQ7 homolog) catalyzes the production of coenzyme Q (CoQ) in mitochondria. The predicted protein contains 179 amino acids, is mostly helical, and contains an alpha-helical membrane insertion. It has a potential N-glycosylation site, a phosphorylation site for protein kinase C and another for casein kinase II, and 3 N-myristoylation sites. This protein has 2 isoforms produced by alternative splicing with MW 20-24 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7161 Product name: Recombinant human COQ7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC003185 Sequence: MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL Predict reactive species\nFull Name: coenzyme Q7 homolog, ubiquinone (yeast)\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 20~24 kDa\nGenBank Accession Number: BC003185\nGene Symbol: COQ7\nGene ID (NCBI): 10229\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99807\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888728723625,"sku":"86394-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86394-1-rr","provider":"Iright","version":"1.0","type":"link"}