Proteintech, 86413-1-RR, RFX4 Recombinant monoclonal antibody

Size: 20ul / 100ul The RFX4 (86413-1-RR) by Proteintech is a Recombinant antibody targeting RFX4 in WB, ELISA applications with reactivity to human, mouse, rat samples 86413-1-RR targets RFX4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, mouse brain tissue, rat brain tissue, fetal human brain tissue, mouse testis tissue, rat testis tissue, human testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information RFX4, also named as NYD-SP10, contains one RFX-type winged-helix DNA-binding domain and belongs to the RFX family. It may activate transcription by interacting directly with the X-box. The protein is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4119 Product name: Recombinant Human RFX4 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 140-190 aa of BC030644 Sequence: YYDVMYSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLP Predict reactive species Full Name: regulatory factor X, 4 (influences HLA class II expression) Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 84 kDa GenBank Accession Number: BC030644 Gene Symbol: RFX4 Gene ID (NCBI): 5992 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q33E94 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.