Proteintech, 86446-1-RR, SNX29 Recombinant monoclonal antibody

Size: 20ul / 100ul The SNX29 (86446-1-RR) by Proteintech is a Recombinant antibody targeting SNX29 in WB, ELISA applications with reactivity to human samples 86446-1-RR targets SNX29 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins classified by the presence of a phospholipid-binding motif PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX29 (Sorting nexin 29) is associated with bipolar disorder (BPD) and major depressive disorder (MDD) in the Han population (PMID: 33143498). The expression of SNX29 is significantly upregulated in most tumor tissues, and its expression is associated with the progression, immune infiltration and drug sensitivity of various cancers (PMID: 36829159). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32618 Product name: Recombinant human SNX29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of XM_011522738 Sequence: MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGLKRSRGLALTAAAIKQAAGFASKTETEPVFWYYVKEVLNKHELQRFYSLRHIASDVGRGRAWLRCALNEHSLERYLHMLLADRCRLSTFYEDWS Predict reactive species Full Name: sorting nexin 29 Calculated Molecular Weight: 91kd Observed Molecular Weight: 90 kDa GenBank Accession Number: XM_011522738 Gene Symbol: SNX29 Gene ID (NCBI): 92017 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8TEQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.