{"product_id":"proteintech-86452-1-rr","title":"Proteintech, 86452-1-RR, FOXK1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FOXK1 (86452-1-RR) by Proteintech is a Recombinant antibody targeting FOXK1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n86452-1-RR targets FOXK1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HeLa cells,  HEK-293T cells,  Jurkat cells,  K-562 cells,  NIH\/3T3 cells,  PC-12 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nForkhead box (FOX) domains bind DNA and consist of 2 loops connecting beta-sheets that flank an alpha-helix, which is a group of highly conserved transcription factors. Forkhead box k1 (FOXK1) also known as MNF, is a transcription factor that belongs to the forkhead family consisting of the winged-helix DNA-binding domain and the N-terminal and C-terminal transcriptional domains(PMID: 15289879, PMID: 27223064). There are two isoforms of FoxK1: FoxK1-α and FoxK1-β. FoxK1-α (90 kDa) is expressed in committed myoblasts and differentiated myotubes, while FoxK1-β (55 kDa) is expressed mainly in quiescent satellite cells(PMID: 9271401).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag28820 Product name: Recombinant human FOXK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001037165 Sequence: MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPAAAPPPAPAQPQPPPGPPPPPPPPLPPGAIAGAGSSGGSSGVSGDSAVAGAAPALVAAAAASVRQ Predict reactive species\nFull Name: forkhead box K1\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 90-100 kDa\nGenBank Accession Number: NM_001037165\nGene Symbol: FOXK1\nGene ID (NCBI): 221937\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P85037\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888753463465,"sku":"86452-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86452-1-rr","provider":"Iright","version":"1.0","type":"link"}