{"product_id":"proteintech-86460-1-rr","title":"Proteintech, 86460-1-RR, DIRAS2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DIRAS2 (86460-1-RR) by Proteintech is a Recombinant antibody targeting DIRAS2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86460-1-RR targets DIRAS2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  fetal human brain tissue,  mouse cerebellum tissue,  rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGTP-binding protein Di-Ras2 (DIRAS2) is a member of the Ras-related small G-protein family. DIRAS2 regulated the phosphorylation of downstream effector proteins and activated the RAS\/mitogen-activated protein kinase (MAPK) signaling pathway (PMID: 3216131). DIRAS2 interacted with 26S proteasome non-ATPase regulatory subunit 2, which facilitates the degradation of DIRAS2 in a proteasome-mediated way. DIRAS2 blocked nuclear factor kappa light-chain enhancer of activated B-cell (NF-κB) signaling pathways, inducing G0\/G1 arrest. DIRAS2 inhibited CRC cell proliferation and affected cell-cycle protein expression (PMID: 35173535). DIRAS2 was proved to be an oncogene that activated the RAS-MAPK pathway to induce cell proliferation and metastasis in renal cell cancer (PMID: 3216131). DIRAS2 also shows its activity as a tumor-suppressor gene to induce autophagic cell death via modulating nuclear localization FOXO3\/FOXO3A and TFEB (PMID: 29368982).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7926 Product name: Recombinant human DIRAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC008065 Sequence: MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM Predict reactive species\nFull Name: DIRAS family, GTP-binding RAS-like 2\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC008065\nGene Symbol: DIRAS2\nGene ID (NCBI): 54769\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96HU8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888736358569,"sku":"86460-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86460-1-rr","provider":"Iright","version":"1.0","type":"link"}