{"product_id":"proteintech-86482-1-rr","title":"Proteintech, 86482-1-RR, CCL17\/TARC Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CCL17\/TARC (86482-1-RR) by Proteintech is a Recombinant antibody targeting CCL17\/TARC in WB, ELISA applications with reactivity to mouse samples\n86482-1-RR targets CCL17\/TARC in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NR8383 cells, MH-S cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL17, also named as TARC, is a member of the CC chemokine family, and is highly expressed by thymus and other cells, including keratinocytes, endothelial cells, dendritic cells, bronchial epithelial cells and fibroblasts. CCL17 plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. CCL17 induced chemotaxis and Ca2+ influx in the cells stably expressing CCR4, thereby demonstrating the ligand-receptor relationship between CCL17 and CCR4.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3319 Product name: recombinant mouse Ccl17 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-93 aa of NM_011332.3 Sequence: ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP Predict reactive species\nFull Name: chemokine (C-C motif) ligand 17\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: NM_011332.3\nGene Symbol: Ccl17\nGene ID (NCBI): 20295\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: F6R5P4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888717222057,"sku":"86482-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86482-1-rr","provider":"Iright","version":"1.0","type":"link"}