{"product_id":"proteintech-86504-3-rr","title":"Proteintech, 86504-3-RR, PBX1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PBX1 (86504-3-RR) by Proteintech is a Recombinant antibody targeting PBX1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n86504-3-RR targets PBX1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-12 cells,  NIH\/3T3 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPBX1, also named as Pre-B-cell leukemia transcription factor 1, is a 430 amino acid protein, which belongs to the TALE\/PBX homeobox family. PBX1 is expressed in all tissues except in cells of the B and T lineage. PBX1 acts as a transcriptional activator of PF4 in complex with MEIS1. PBX1 may have a role in steroidogenesis and, subsequently, sexual development and differentiation. Isoform PBX1b as part of a PDX1:PBX1b: MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer. PBX1 exists two isoforms (PBX1a and PBX1b), and molecular weight of PBX1 is 47 kDa and 38 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag12817 Product name: Recombinant human PBX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-349 aa of BC101578 Sequence: MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMS Predict reactive species\nFull Name: pre-B-cell leukemia homeobox 1\nCalculated Molecular Weight: 430 aa, 47 kDa\nObserved Molecular Weight: 38 kDa, 47 kDa\nGenBank Accession Number: BC101578\nGene Symbol: PBX1\nGene ID (NCBI): 5087\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P40424\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888796749993,"sku":"86504-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86504-3-rr","provider":"Iright","version":"1.0","type":"link"}