Iright
BRAND / VENDOR: Proteintech

Proteintech, 86528-1-RR, REXO4 Recombinant monoclonal antibody

CATALOG NUMBER: 86528-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The REXO4 (86528-1-RR) by Proteintech is a Recombinant antibody targeting REXO4 in WB, IF/ICC, ELISA applications with reactivity to human samples 86528-1-RR targets REXO4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, A549 cells, K-562 cells, PC-3 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:750-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13473 Product name: Recombinant human REXO4,REX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 71-422 aa of BC009274 Sequence: WKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEMVGVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLKGRILVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSGRPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSDDA Predict reactive species Full Name: REX4, RNA exonuclease 4 homolog (S. cerevisiae) Calculated Molecular Weight: 422 aa, 47 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC009274 Gene Symbol: REXO4 Gene ID (NCBI): 57109 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9GZR2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924