{"product_id":"proteintech-86530-1-rr","title":"Proteintech, 86530-1-RR, SAMD4A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SAMD4A (86530-1-RR) by Proteintech is a Recombinant antibody targeting SAMD4A in WB, ELISA applications with reactivity to human, mouse, rat samples\n86530-1-RR targets SAMD4A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSAMD4A is also named as KIAA1053, SAMD4, SMAUG1, hSmaug1 and belongs to the SMAUG family. SAMD4A acts as a translational repressor of SRE-containing messengers. (PMID:16221671). In particular, as orthologous alternative splicing isoforms, mouse Samd4a E-form and human SAMD4A C-form containing the SAM domain were specific to testes. Samd4a\/SAMD4A plays an essential role in normal spermatogenesis, and SAMD4A, as a spermatid specific marker, can be used for subcategorizing nonobstructive azoospermia patients (PMID:36274854). In mammalian cells, human SAMD4A can form a kind of mRNA‐silencing foci in the cytoplasm, acting differently from processing body and stress granules. Recently, it was reported that human SAMD4A can protect the host from viral infection by degrading viral RNA (PMID: 32341522). Indition, 14-3-3s negatively regulate the localization of the RNA-binding protein SAMD4A to cytoplasmic granules and inhibit its activity as a translational repressor (PMID: 36931259).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag11273 Product name: Recombinant human SAMD4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-383 aa of BC021726 Sequence: LLNPYQAAAWDSICPIHWRLTDIIEGGSLRIPLQELHQMILTPIKAYSSPSTTPEARRREPQAPRQPSLMGPESQSPDCKDGAAATGATATPSAGASGGLQPHQLSSCDGELAVAPLPEGDLPGQFTRVMGKVCTQLLVSRPDEENISSYLQLIDKCLIHEAFTETQKKRLLSWKQQVQKLFRSFPRKTLLDISGYRQQRNRGFGQSNSLPTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQNLWFANPGGSNSMPSRTHSSVQRTRSLPVHTSPQNMLMFQQPGSQVHSGLCLTDLRGWLSLSGAPSMPALTVPKSSQGEFQLPVTEPDINNRLESLCLSMTEHALGDGVDRTSTI Predict reactive species\nFull Name: sterile alpha motif domain containing 4A\nCalculated Molecular Weight: 529 aa, 59 kDa\nObserved Molecular Weight: 70-71 kDa\nGenBank Accession Number: BC021726\nGene Symbol: SAMD4A\nGene ID (NCBI): 23034\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UPU9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888818311337,"sku":"86530-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86530-1-rr","provider":"Iright","version":"1.0","type":"link"}