Proteintech, 86541-2-RR, Shootin 1 Recombinant monoclonal antibody

Size: 20ul / 100ul The Shootin 1 (86541-2-RR) by Proteintech is a Recombinant antibody targeting Shootin 1 in WB, ELISA applications with reactivity to human, mouse samples 86541-2-RR targets Shootin 1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SK-N-SH cells, SH-SY5Y cells, HeLa cells, Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Shootin 1, also known as SHTN1, KIAA1598, contains 3 coiled-coil domains and a proline-rich region. Shootin 1 is involved in generating internal asymmetric signals required for neuronal during stages 2 and 3. Shootin 1 plays a role in cytoskeletal organization by regulating the subcellular localization of phosphoinositide 3-kinase (PI3K) activity at the axonal growth cone. SHTN1 produces 2 splice variants, a short variant, SHTN1S, that lacks exons 15 and 16, and a long variant, SHTN1L, that includes exons 1 through 17(PMID: 17030985, 30733148). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18294 Product name: Recombinant human KIAA1598 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 834-1066 aa of BC022348 Sequence: TEEVTDLKRQAVEEMMDRIKKGVHLRPVNQTARPKTKPESSKGCESAVDELKGILGTLNKSTSSRSLKSLDPENSETELERILRRRKVTAEADSSSPTGILATSESKSMPVLGSVSSVTKTALNKKTLEAEFNSPSPPTPEPGEGPRKLEGCTSSKVTFQPPSSIGCRKKYIDGEKQAEPVVVLDPVSTHEPQTKDQVAEKDPTQHKEDEGEIQPENKEDSIENVRETDSSNC Predict reactive species Full Name: KIAA1598 Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 60-80 kDa GenBank Accession Number: BC022348 Gene Symbol: Shootin 1 Gene ID (NCBI): 57698 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A0MZ66 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.