{"product_id":"proteintech-86545-3-rr","title":"Proteintech, 86545-3-RR, CCL6\/C10  Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CCL6\/C10  (86545-3-RR) by Proteintech is a Recombinant antibody targeting CCL6\/C10  in WB, IF\/ICC, ELISA applications with reactivity to mouse samples\n86545-3-RR targets CCL6\/C10  in WB, IF\/ICC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Transfected with Mouse Ccl6 HEK-293T cells\nPositive IF\/ICC detected in: Transfected HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL6, formerly known as C10 or MRP-1 (Macrophage Inflammatory Protein-Related Protein-1), is a small secretory protein belonging to the CC chemokine family. Chemokines are a large family of cytokines, or signaling proteins, renowned for their ability to induce directed migration (chemotaxis) of nearby responsive cells. CCL6 is a crucial CC chemokine in mice that acts primarily through the CCR1 receptor to orchestrate the migration and activation of key immune cells. It is a central mediator in inflammation, host defense, and pathological processes like cancer and fibrosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2957 Product name: Recombinant Mouse CCL6 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-116 aa of NM_009139.3 Sequence: GLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA Predict reactive species\nFull Name: chemokine (C-C motif) ligand 6\nCalculated Molecular Weight: 13 kDa\nGenBank Accession Number: NM_009139.3\nGene Symbol: Ccl6\nGene ID (NCBI): 20305\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P27784\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888717418665,"sku":"86545-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86545-3-rr","provider":"Iright","version":"1.0","type":"link"}