{"product_id":"proteintech-86551-3-rr","title":"Proteintech, 86551-3-RR, MMS2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MMS2 (86551-3-RR) by Proteintech is a Recombinant antibody targeting MMS2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n86551-3-RR targets MMS2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, HeLa cells,  HEK-293 cells,  mouse liver tissue,  rat liver tissue,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMMS2 encodes a 137-amino acid, 15.2-kDa protein with significant sequence homology to a conserved family of ubiquitin-conjugating (Ubc) proteins (PMID: 9576943). Mms2 is a ubiquitin E2-variant protein with a very well-documented function in the tolerance pathway that protects both human and yeast cells from the lethal and mutagenic effects of DNA damage (PMID: 36934633). A high expression level of human MMS2 is associated with poor survival prognosis in different cancer diseases (PMID: 36934633).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1111 Product name: Recombinant human UBE2V2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC007051 Sequence: MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2 variant 2\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16-18 kDa\nGenBank Accession Number: BC007051\nGene Symbol: MMS2\nGene ID (NCBI): 7336\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15819\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888783970473,"sku":"86551-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86551-3-rr","provider":"Iright","version":"1.0","type":"link"}