Proteintech, 86560-1-RR, RAB12 Recombinant monoclonal antibody

Size: 20ul / 100ul The RAB12 (86560-1-RR) by Proteintech is a Recombinant antibody targeting RAB12 in WB, ELISA applications with reactivity to human, mouse, rat samples 86560-1-RR targets RAB12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information RAB12 belongs to the small GTPase superfamily and Rab family. RAB12 locates in Golgi apparatus membrane. Rab12, a previously uncharacterized Rab isoform, is mainly localized at TfR-positive recycling endosomes and is specifically involved in TfR degradation. Rab12 is a regulator of LRRK2 and its activation by damaged lysosomes. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31627 Product name: Recombinant human RAB12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-244 aa of NM_001025300 Sequence: NSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC Predict reactive species Full Name: RAB12, member RAS oncogene family Calculated Molecular Weight: 27KD Observed Molecular Weight: 27 kDa GenBank Accession Number: NM_001025300 Gene Symbol: RAB12 Gene ID (NCBI): 201475 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6IQ22 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.