{"product_id":"proteintech-86560-1-rr","title":"Proteintech, 86560-1-RR, RAB12 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RAB12 (86560-1-RR) by Proteintech is a Recombinant antibody targeting RAB12 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86560-1-RR targets RAB12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB12 belongs to the small GTPase superfamily and Rab family. RAB12 locates in Golgi apparatus membrane. Rab12, a previously uncharacterized Rab isoform, is mainly localized at TfR-positive recycling endosomes and is specifically involved in TfR degradation. Rab12 is a regulator of LRRK2 and its activation by damaged lysosomes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag31627 Product name: Recombinant human RAB12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-244 aa of NM_001025300 Sequence: NSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC Predict reactive species\nFull Name: RAB12, member RAS oncogene family\nCalculated Molecular Weight: 27KD\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: NM_001025300\nGene Symbol: RAB12\nGene ID (NCBI): 201475\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6IQ22\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888812314793,"sku":"86560-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86560-1-rr","provider":"Iright","version":"1.0","type":"link"}