Proteintech, 86572-2-RR, ZDHHC8 Recombinant monoclonal antibody

Size: 20ul / 100ul The ZDHHC8 (86572-2-RR) by Proteintech is a Recombinant antibody targeting ZDHHC8 in WB, ELISA applications with reactivity to human samples 86572-2-RR targets ZDHHC8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, HeLa cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26028 Product name: Recombinant human ZDHHC8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 274-430 aa of BC053544 Sequence: LLDRAAPLKVKLSDNGLKAGLGRSKSKGSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPPTPAMYKFRPAFPTGPKVPFCGPGEQVPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPLSASDAFSGAL Predict reactive species Full Name: zinc finger, DHHC-type containing 8 Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 70-85 kDa GenBank Accession Number: BC053544 Gene Symbol: ZDHHC8 Gene ID (NCBI): 29801 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9ULC8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.