{"product_id":"proteintech-86577-1-rr","title":"Proteintech, 86577-1-RR, Pon3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Pon3 (86577-1-RR) by Proteintech is a Recombinant antibody targeting Pon3 in WB, ELISA applications with reactivity to mouse, rat samples\n86577-1-RR targets Pon3 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue,  mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPON3 (paraoxonase 3) is a member of the paraoxonase gene family and shares high homology with PON1 and PON2. The PON3 protein is primarily synthesized by the liver and can bind to high-density lipoprotein (HDL), where it exerts antioxidant functions. PON3 can prevent the oxidation of low-density lipoprotein (LDL) and disrupt bacterial quorum-sensing molecules. Additionally, PON3 is expressed in mouse models of Alzheimer's disease (AD), with positive staining for PON3 detected in astrocytes surrounding Aβ plaques. These findings suggest that PON3 plays an important role in antioxidant stress and lipid peroxidation and may have potential protective effects on pathological processes such as neurodegenerative diseases and atherosclerosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2743 Product name: Recombinant Mouse Pon3 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-354 aa of NM_173006.1 Sequence: RLLNFRERVSTTREIKATEPQNCHLIEGLENGSEDIDILPSGLAFISTGLKYPGMPAFAPDKPGRIFLMDLNEQNPEAQALEISGGLDQESLNPHGISTFIDKDNTAYLYVVNHPNMDSTVEIFKFEEQQRSLIHLKTLKHELLKSVNDIVVLGPEQFYATRDHYFTSYFLVLLEMILDPHWTSVVFYSPKEVKVVAQGFSSANGITVSLDQKFVYVADVTAKNIHIMKKHDNWDLTPVKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLIYNPEDPPGSEVLRIQDSLSDKPRVSTLYANNGSVLQGSTVASVYHKRMLIGTIFHKALYCDL Predict reactive species\nFull Name: paraoxonase 3\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: NM_173006.1\nGene Symbol: Pon3\nGene ID (NCBI): 269823\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q62087\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888809398441,"sku":"86577-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86577-1-rr","provider":"Iright","version":"1.0","type":"link"}