{"product_id":"proteintech-86588-2-rr","title":"Proteintech, 86588-2-RR, CD32 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD32 (86588-2-RR) by Proteintech is a Recombinant antibody targeting CD32 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n86588-2-RR targets CD32 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells, K-562 cells\nPositive IF\/ICC detected in: U-937 cells, K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD32 (FcγRII) is a 40 kD transmembrane glycoprotein that binds to the Fc region of IgG with low affinity. CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2713 Product name: Recombinant Human FCGR2A\/CD32a protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 34-217 aa of NM_001136219.3 Sequence: QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG Predict reactive species\nFull Name: Fc fragment of IgG, low affinity IIa, receptor (CD32)\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: NM_001136219.3\nGene Symbol: CD32a\nGene ID (NCBI): 2212\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P12318-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888720924841,"sku":"86588-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86588-2-rr","provider":"Iright","version":"1.0","type":"link"}