{"product_id":"proteintech-86595-3-rr","title":"Proteintech, 86595-3-RR, PBX3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PBX3 (86595-3-RR) by Proteintech is a Recombinant antibody targeting PBX3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86595-3-RR targets PBX3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  fetal human brain tissue,  mouse brain tissue,  rat brain tissue,  mouse lung tissue,  rat lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPBX3 is a homeodomain-containing transcription factor of the pre-B cell leukemia (PBX) family, members of which have extensive roles in early development and some adult processes. It plays crucial roles in embryonic development, organogenesis, and cell differentiation by regulating the expression of downstream target genes. Beyond its physiological functions, PBX3 is increasingly recognized for its significant involvement in oncogenesis. It is frequently overexpressed in various malignancies, including leukemias and solid tumors, where it promotes cell proliferation, inhibits apoptosis, enhances invasion and metastasis, and contributes to chemotherapy resistance.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3239 Product name: Recombinant human PBX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-367 aa of BC016977 Sequence: QLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQSLVKDPKERGSKGSDIQPTSVVSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN Predict reactive species\nFull Name: pre-B-cell leukemia homeobox 3\nCalculated Molecular Weight: 434 aa, 47 kDa\nObserved Molecular Weight: 47-50 kDa\nGenBank Accession Number: BC016977\nGene Symbol: PBX3\nGene ID (NCBI): 5090\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P40426\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888796782761,"sku":"86595-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86595-3-rr","provider":"Iright","version":"1.0","type":"link"}