{"product_id":"proteintech-86599-1-rr","title":"Proteintech, 86599-1-RR, Peroxiredoxin 2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Peroxiredoxin 2 (86599-1-RR) by Proteintech is a Recombinant antibody targeting Peroxiredoxin 2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n86599-1-RR targets Peroxiredoxin 2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, C2C12 cells,  mouse brain tissue,  rat brain tissue,  rat spleen tissue,  rat heart tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeroxiredoxin 2 (PRDX2), also named as TSA, PRP, NKEFB and TDPX1, belongs to the ahpC\/TSA family. It is known to act as an antioxidant enzyme whose main function is H2O2 reduction in cells. PRDX2 is involved in redox regulation of the cell. It reduces peroxides with reducing equivalents provided through the thioredoxin system. It may play an important role in eliminating peroxides generated during metabolism. PRDX2 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. PRDX2 actions may be related to the expression of NFKB and IKB.(PMID:21248284)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0835 Product name: Recombinant human PRDX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC003022 Sequence: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN Predict reactive species\nFull Name: peroxiredoxin 2\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC003022\nGene Symbol: peroxiredoxin 2\nGene ID (NCBI): 7001\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P32119\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888798519465,"sku":"86599-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86599-1-rr","provider":"Iright","version":"1.0","type":"link"}