{"product_id":"proteintech-86607-3-rr","title":"Proteintech, 86607-3-RR, CCL20\/MIP-3 alpha Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CCL20\/MIP-3 alpha (86607-3-RR) by Proteintech is a Recombinant antibody targeting CCL20\/MIP-3 alpha in WB, IHC, ELISA applications with reactivity to rat samples\n86607-3-RR targets CCL20\/MIP-3 alpha in WB, IHC, ELISA applications and shows reactivity with rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Transfected with Rat CCL20\/MIP-3 alpha HEK-293T cells\nPositive IHC detected in: rat liver tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL20, also known as macrophage inﬁltrating factor protein 3α, is a C-C chemokine that speciﬁcally binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3237 Product name: Recombinant Rat CCL20\/MIP-3 alpha protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 27-96 aa of NM_019233.1 Sequence: SNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM Predict reactive species\nFull Name: chemokine (C-C motif) ligand 20\nCalculated Molecular Weight: 11 kDa\nGenBank Accession Number: NM_019233.1\nGene Symbol: Ccl20\nGene ID (NCBI): 29538\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P97884\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888717254825,"sku":"86607-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86607-3-rr","provider":"Iright","version":"1.0","type":"link"}