{"product_id":"proteintech-86610-2-rr","title":"Proteintech, 86610-2-RR, CUEDC2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CUEDC2 (86610-2-RR) by Proteintech is a Recombinant antibody targeting CUEDC2 in WB, IHC, ELISA applications with reactivity to human samples\n86610-2-RR targets CUEDC2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells,  HCT 116 cells,  ACHN cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCUE domain-containing 2 (CUEDC2) is a ubiquitin-binding motif-containing protein involved in the regulation of the cell cycle, inflammation, and tumorigenesis. It is ubiquitously expressed in human tissues and organs, not only highly expressed in the normal brain, heart and testis, but also some kinds of cancers, such as breast, ovarian and kidney cancers. CUEDC2 could act as an adaptor protein to target IκB kinase (IKK) for dephosphorylation and inactivation by recruiting protein phosphatase (PP1), and thus repressed activation of the transcription factor NF-κB. Moreover, CUEDC2, is a key factor in endocrine resistance in breast cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag13847 Product name: Recombinant human CUEDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC000262 Sequence: MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA Predict reactive species\nFull Name: CUE domain containing 2\nCalculated Molecular Weight: 287 aa, 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC000262\nGene Symbol: CUEDC2\nGene ID (NCBI): 79004\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H467\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888730788009,"sku":"86610-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86610-2-rr","provider":"Iright","version":"1.0","type":"link"}