{"product_id":"proteintech-86614-2-rr","title":"Proteintech, 86614-2-RR, PHD1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PHD1 (86614-2-RR) by Proteintech is a Recombinant antibody targeting PHD1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86614-2-RR targets PHD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, rat testis tissue,  HEK-293 cells,  HepG2 cells,  A549 cells,  BT-474 cells,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPHD1, also named as EGLN2, EIT6 and HPH-3, catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates HIF-1 alpha at 'Pro-402' and 'Pro-564', and HIF-2 alpha. EGLN2 functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. It may play a role in cell growth regulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3616 Product name: Recombinant human EGLN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 190-407 aa of BC036051 Sequence: GICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT Predict reactive species\nFull Name: egl nine homolog 2 (C. elegans)\nCalculated Molecular Weight: 407 aa, 44 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC036051\nGene Symbol: PHD1\nGene ID (NCBI): 112398\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96KS0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888799207593,"sku":"86614-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86614-2-rr","provider":"Iright","version":"1.0","type":"link"}