{"product_id":"proteintech-86690-1-rr","title":"Proteintech, 86690-1-RR, CROP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CROP (86690-1-RR) by Proteintech is a Recombinant antibody targeting CROP in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n86690-1-RR targets CROP in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, RT-4 cells,  HepG2 cells,  mouse brain tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCROP, a putative SR protein, contain cystine\/histidine motifs and leucine zipper-like repeats in the N-terminal half and consists mostly of charged and polar amino acids in the C-terminal half. CROP has a high expression in heart, brain, pancreas, thymus, and weak in lung, live and kidney. As the human homologue of yeast Luc7p, CROP is supported to be participated in 5'-splice site recognize and is essential for vegetative growth. This is a rabbit polyclonal antibody raised against part of N-terminus of CROP of human origin, and can recognize a ~58kDa band of CROP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5961 Product name: Recombinant human CROP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC056409 Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE Predict reactive species\nFull Name: cisplatin resistance-associated overexpressed protein\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 55-58 kDa\nGenBank Accession Number: BC056409\nGene Symbol: CROP\nGene ID (NCBI): 51747\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O95232\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888608006313,"sku":"86690-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86690-1-rr","provider":"Iright","version":"1.0","type":"link"}