{"product_id":"proteintech-86698-1-rr","title":"Proteintech, 86698-1-RR, CXCL7\/PPBP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CXCL7\/PPBP (86698-1-RR) by Proteintech is a Recombinant antibody targeting CXCL7\/PPBP in WB, IF\/ICC, ELISA applications with reactivity to human samples\n86698-1-RR targets CXCL7\/PPBP in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human peripheral blood platelets\nPositive IF\/ICC detected in: Transfected CHO-K1\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPBP, also named as CXCL7, NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3690 Product name: Recombinant Human CXCL7\/PBP protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 59-128 aa of NM_002704.3 Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD Predict reactive species\nFull Name: pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)\nCalculated Molecular Weight: 14kDa\nObserved Molecular Weight: 8-14 kDa\nGenBank Accession Number: NM_002704.3\nGene Symbol: PPBP\nGene ID (NCBI): 5473\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02775\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888731607209,"sku":"86698-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86698-1-rr","provider":"Iright","version":"1.0","type":"link"}