Proteintech, 86699-1-RR, UGP2 Recombinant monoclonal antibody

Size: 20ul / 100ul The UGP2 (86699-1-RR) by Proteintech is a Recombinant antibody targeting UGP2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86699-1-RR targets UGP2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse liver tissue, rat liver tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information UDP-glucose pyrophosphorylase 2 (UGP2, synonyms: UDPG, UGPP2, UDPGP2, Phc379)is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. So far two isoforms are encoded by two transcript variants have been found. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0590 Product name: Recombinant human UGP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-288 aa of BC002954 Sequence: SQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYE Predict reactive species Full Name: UDP-glucose pyrophosphorylase 2 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 50-56 kDa GenBank Accession Number: BC002954 Gene Symbol: UGP2 Gene ID (NCBI): 7360 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16851 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.