{"product_id":"proteintech-86712-3-rr","title":"Proteintech, 86712-3-RR, LIX1L Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe LIX1L (86712-3-RR) by Proteintech is a Recombinant antibody targeting LIX1L in WB, IP, ELISA applications with reactivity to human samples\n86712-3-RR targets LIX1L in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  SH-SY5Y cells,  K-562 cells,  HL-60 cells\nPositive IP detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLimb expression 1-like protein (LIX1L) is a putative RNA binding protein that contains a double-stranded RNA-binding motif. LIX1L is highly expressed in various cancer tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag22209 Product name: Recombinant human LIX1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC035727 Sequence: METMRAQRLQPGVGTSGRGTLRALRPGVTGAAAATATPPAGPPPAPPPPAPPPPPLLLSGAPGLPLPPGAAGSPAVLREAVEAVVRSFAKHTQGYGRVNVVE Predict reactive species\nFull Name: Lix1 homolog (mouse)-like\nCalculated Molecular Weight: 337 aa, 37 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC035727\nGene Symbol: LIX1L\nGene ID (NCBI): 128077\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8IVB5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888776663209,"sku":"86712-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86712-3-rr","provider":"Iright","version":"1.0","type":"link"}