Proteintech, 86724-1-RR, TMEM35 Recombinant monoclonal antibody

Size: 20ul / 100ul The TMEM35 (86724-1-RR) by Proteintech is a Recombinant antibody targeting TMEM35 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 86724-1-RR targets TMEM35 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, mouse spinal cord tissue, rat spinal cord tissue, mouse cerebellum tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TMEM35 is a 167-amino acid peptide with a putative NH2 terminal signal peptide, three hydrophobic transmembrane domains, and a nerve growth factor binding domain.TMEM35is 18kDa and has been shown to localize to membrane-bound structures within cells. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20589 Product name: Recombinant human TMEM35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-167 aa of BC078658 Sequence: LTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS Predict reactive species Full Name: transmembrane protein 35 Calculated Molecular Weight: 167 aa, 18 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC078658 Gene Symbol: TMEM35 Gene ID (NCBI): 59353 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q53FP2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.