Proteintech, 86726-1-RR, ZW10 Recombinant monoclonal antibody

Size: 20ul / 100ul The ZW10 (86726-1-RR) by Proteintech is a Recombinant antibody targeting ZW10 in WB, IF/ICC, ELISA applications with reactivity to human samples 86726-1-RR targets ZW10 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, Ramos cells, K-562 cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ZW10 is the human homolog of the Drosophila melanogaster Zw10 protein. ZW10 is localized to kinetochores and kinetochore-associated microtubules and is an essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis(PMID: 17102640). ZW10 proteins in Drosophila and HeLa cells display a similar and intriguing cell cycle-dependent intracellular distribution. ZW10 protein first becomes localized to the kinetochore at prometaphase, but then appears to move onto the kinetochore microtubules of the spindle at metaphase, and then back to the kinetochore at anaphase(PMID: 9700164). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19138 Product name: Recombinant human ZW10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 318-672 aa of BC128264 Sequence: NEKTSTVPLAEMLGDMIWEDLSECLIKNCLVYSIPTNSSKLQQYEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSEIHNTVKIIPDSKINVPELPTPDEDNKLEVQKVSNTQYHEVMNLEPENTLDQHSFSLPTCRISESVKKLMELAYQTLLEATTSSDQCAVQLFYSVRNIFHLFHDVVPTYHKENLQKLPQLAAIHHNNCMYIAHHLLTLGHQFRLRLAPILCDGTATFVDLVPGFRRLGTECFLAQMRAQKGELLERLSSARNFSNMDDEENYSAASKAVRQVLHQLKRLGIVWQDVLPVNIYCKAMGTLLNTAISEVIGKITALE Predict reactive species Full Name: ZW10, kinetochore associated, homolog (Drosophila) Calculated Molecular Weight: 779 aa, 89 kDa Observed Molecular Weight: 88 kDa GenBank Accession Number: BC128264 Gene Symbol: ZW10 Gene ID (NCBI): 9183 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43264 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.