Proteintech, 86758-3-RR, Serpin A4/Kallistatin Recombinant monoclonal antibody

Size: 20ul / 100ul The Serpin A4/Kallistatin (86758-3-RR) by Proteintech is a Recombinant antibody targeting Serpin A4/Kallistatin in WB, ELISA applications with reactivity to human samples 86758-3-RR targets Serpin A4/Kallistatin in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Serpin A4 is also named Kallistatin and Peptidase inhibitor 4 (PI-4). Kallistatin was first identified in human plasma as a tissue kallikrein-binding protein and a serine proteinase inhibitor. Kallistatin via its two structural elements regulates differential signaling cascades, and thus a wide spectrum of biological functions (PMID: 28427524). Kallistatin via the active site promotes neovascularization by stimulating VEGF levels in endothelial progenitor cells. Second, kallistatin inhibits or induces apoptosis depending on cell types. Kallistatin via its heparin-binding site inhibits angiogenesis by blocking vascular endothelial growth factor (VEGF)-induced growth, migration and adhesion of endothelial cells. Kallistatin can act as an antioxidant or pro-oxidant (PMID: 28742513). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4707 Product name: Recombinant Human Serpin A4/Kallistatin protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 21-427 aa of NM_001289033.1 Sequence: QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP Predict reactive species Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: NM_001289033.1 Gene Symbol: Kallistatin Gene ID (NCBI): 5267 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P29622 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.