{"product_id":"proteintech-86787-1-rr","title":"Proteintech, 86787-1-RR, RAB10 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RAB10 (86787-1-RR) by Proteintech is a Recombinant antibody targeting RAB10 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n86787-1-RR targets RAB10 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  HUVEC cells,  C2C12 cells,  NIH\/3T3 cells,  mouse brain tissue,  rat brain tissue\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB10 is a member of the RAB family of small GTPases, which are key regulators of vesicular trafficking. RAB proteins are cyclically controlled, requiring a GDP-GTP exchange that is facilitated by RAB guanine nucleotide exchange factors. Rab10 plays essential functional roles in development: mice are embryonic lethal when both alleles are deleted. In addition, RAB10 plays a role in maintenance and regulation of endoplasmic reticulum (ER) morphology. RAB10 function has also been linked to neuronal morphology and polarization, playing a critical role in axonal development and dendrite arborization.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25830 Product name: Recombinant human RAB10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-200 aa of BC000896 Sequence: RVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC Predict reactive species\nFull Name: RAB10, member RAS oncogene family\nCalculated Molecular Weight: 200 aa, 23 kDa\nObserved Molecular Weight: 20-23 kDa\nGenBank Accession Number: BC000896\nGene Symbol: RAB10\nGene ID (NCBI): 10890\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P61026\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888812282025,"sku":"86787-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86787-1-rr","provider":"Iright","version":"1.0","type":"link"}