{"product_id":"proteintech-86799-1-rr","title":"Proteintech, 86799-1-RR, UPK1A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe UPK1A (86799-1-RR) by Proteintech is a Recombinant antibody targeting UPK1A in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n86799-1-RR targets UPK1A in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse bladder tissue, rat bladder tissue\nPositive IF-P detected in: mouse bladder tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUroplakins are a group of urothelial differentiation-related membrane proteins. They are components of the asymmetric unit membrane (AUM), which forms the apical plaques of mammalian urothelium and is believed to play a role in strengthening the urothelial apical surface thus preventing the cells from rupturing during bladder distention (PMID: 8175808). Uroplakin-1a (UPK1A) belongs to the tetraspanin (TM4SF) family. UPK1A plays an important role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag17356 Product name: Recombinant human UPK1A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 111-230 aa of BC107098 Sequence: CITSYTHRDYMVSNPSLITKQMLTFYSADTDQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATPEVVFPWPPLCCRRTGNFIPLNEEGCRLGHMDYLFTKGCFEHIGHAIDSYT Predict reactive species\nFull Name: uroplakin 1A\nCalculated Molecular Weight: 258 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC107098\nGene Symbol: UPK1A\nGene ID (NCBI): 11045\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O00322\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888839610537,"sku":"86799-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86799-1-rr","provider":"Iright","version":"1.0","type":"link"}