{"product_id":"proteintech-86822-1-rr","title":"Proteintech, 86822-1-RR, ZFC3H1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ZFC3H1 (86822-1-RR) by Proteintech is a Recombinant antibody targeting ZFC3H1 in WB, ELISA applications with reactivity to human samples\n86822-1-RR targets ZFC3H1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293T cells,  U2OS cells,  DU 145 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZFC3H1, also known as CCDC131 and PSRC2, is a large protein (1989 amino acids), with a C3H1- type zinc finger motif in its center, and contains five tetratricopeptide (TRP) repeats and six halftetratricopeptide (HAT) repeats at the C-terminal region. It is involved in the processing of a variety of RNAs and plays a critical role in the degradation of nuclear RNAs (PMID: 34514952).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34224 Product name: Recombinant human ZFC3H1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1800-1989 aa of BC156732 Sequence: RNKVQEFKFFTDLVNRCLVTVPARYPIPFSSADYWSNYEFHNRVIFFYLSCVPKTQHSKTLERFCSVMPANSGLALRLLQHEWEESNVQILKLQAKMFTYNIPTCLATWKIAIAAEIVLKGQREVHRLYQRALQKLPLCASLWKDQLLFEASEGGKTDNLRKLVSKCQEIGVSLNELLNLNSNKTESKNH Predict reactive species\nFull Name: zinc finger, C3H1-type containing\nCalculated Molecular Weight: 226 kDa\nObserved Molecular Weight: 260 kDa\nGenBank Accession Number: BC156732\nGene Symbol: ZFC3H1\nGene ID (NCBI): 196441\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O60293\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888843968681,"sku":"86822-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86822-1-rr","provider":"Iright","version":"1.0","type":"link"}