{"product_id":"proteintech-86832-2-rr","title":"Proteintech, 86832-2-RR, SH3PXD2A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SH3PXD2A (86832-2-RR) by Proteintech is a Recombinant antibody targeting SH3PXD2A in WB, ELISA applications with reactivity to human, mouse, rat samples\n86832-2-RR targets SH3PXD2A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, NIH\/3T3 cells,  HSC-T6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSH3PXD2A is also named as FISH, KIAA0418, SH3MD1, TKS5. SH3PXD2A contains an amino-terminal PX domain followed by five SH3 domains. It is a cytoplasmic protein in normal fibroblasts (PMID: 19464300). The p140 and p130 forms of SH3PXD2A may be generated by other splice variations. The complexity of SH3PXD2A isoforms is also evident in different cell types. For example in human platelets a single band of 150 kDa was detected, whereas all three forms were found in human fibroblasts and vascular smooth muscle cells (PMID: 9687503).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag39231 Product name: Recombinant human SH3PXD2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 834-1133 aa of NM_001394015.1 Sequence: TKKEWEGPATSYMTCSAYQKVQDSEISFPAGVEVQVLEKQESGWWYVRFGELEGWAPSHYLVLDENEQPDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSPPPKDNNLSCALRRNESLTATDGLRGVRRNSSFSTARSAAAEAKGRLAERAASQGSDSPLLPAQRNSIPVSPVRPKPIEKSQFIHNNLKDVYVSIADYEGDEETAGFQEGVSMEVLERNPNGWWYCQILDGVKPFKGWVPSNYLEKKN Predict reactive species\nFull Name: SH3 and PX domains 2A\nCalculated Molecular Weight: 125kDa，1133aa\nObserved Molecular Weight: 130-150 kDa\nGenBank Accession Number: NM_001394015.1\nGene Symbol: SH3PXD2A\nGene ID (NCBI): 9644\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q5TCZ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888821489833,"sku":"86832-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86832-2-rr","provider":"Iright","version":"1.0","type":"link"}