Iright
BRAND / VENDOR: Proteintech

Proteintech, 86888-1-RR, PPP1R10 Recombinant monoclonal antibody

CATALOG NUMBER: 86888-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PPP1R10 (86888-1-RR) by Proteintech is a Recombinant antibody targeting PPP1R10 in WB, IF/ICC, ELISA applications with reactivity to human samples 86888-1-RR targets PPP1R10 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20091 Product name: Recombinant human PPP1R10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-318 aa of BC150310 Sequence: MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQLSKSSEDEELRKLASVLVSDWMAVIRSQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKPKSLRTTAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKPIPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDALNSAPVPGIKIKKKKKVLSPTAAK Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 10 Calculated Molecular Weight: 940 aa, 99 kDa Observed Molecular Weight: 99-110 kDa GenBank Accession Number: BC150310 Gene Symbol: PPP1R10 Gene ID (NCBI): 5514 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96QC0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924