Proteintech, 86933-2-RR, VAV1 Recombinant monoclonal antibody

Size: 20ul / 100ul The VAV1 (86933-2-RR) by Proteintech is a Recombinant antibody targeting VAV1 in WB, IF/ICC, ELISA applications with reactivity to human samples 86933-2-RR targets VAV1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, THP-1 cells, K-562 cells, Raji cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Vav proteins mainly act as enzymes that catalyze the activation step of Rho subfamily GTPases during cell signaling. There are three family members:VAV1, VAV2 and VAV3. Vav1 is specifically expressed in the hematopoietic system, whereas Vav2 and Vav3 are more ubiquitously expressed (PMID:14607270). Vav1 is physiologically active as a GDP/GTP nucleotide exchange factor (GEF) in the hematopoietic system (PMID:31654719). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag38665 Product name: Recombinant human VAV1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 442-790 aa of BC013361 Sequence: EQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC Predict reactive species Full Name: vav 1 guanine nucleotide exchange factor Calculated Molecular Weight: 845 aa, 98 kDa Observed Molecular Weight: 98 kDa GenBank Accession Number: BC013361 Gene Symbol: VAV1 Gene ID (NCBI): 7409 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15498 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.