Proteintech, 86951-1-RR, RAB5B Recombinant monoclonal antibody

Size: 20ul / 100ul The RAB5B (86951-1-RR) by Proteintech is a Recombinant antibody targeting RAB5B in WB, ELISA applications with reactivity to human, mouse, rat samples 86951-1-RR targets RAB5B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, NIH/3T3 cells, rat lung tissue, Recombinant protein, mouse lung tissue, HEK-293 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information RAB5B (Ras-related protein Rab-5B) belongs to the Rab family. Rab5 is specifically localized to the early compartment and regulates endocytosis (PMID:1516130, PMID:9087439). There are three isoforms of Rab5 namely, Rab5a, Rab5b, and Rab5c present in EE of mammalian cells (PMID:7789520). Recently, we have shown that Rab5a regulates fluid-phase endocytosis whereas receptor-mediated endocytosis is regulated by Rab5b in Leishmania (PMID:27226564). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5609 Product name: Recombinant human RAB5B protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1-215 aa of NM_001252036.2 Sequence: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN Predict reactive species Full Name: RAB5B, member RAS oncogene family Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24-27 kDa GenBank Accession Number: NM_001252036.2 Gene Symbol: RAB5B Gene ID (NCBI): 5869 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P61020-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.