{"product_id":"proteintech-86960-1-rr","title":"Proteintech, 86960-1-RR, JAM3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe JAM3 (86960-1-RR) by Proteintech is a Recombinant antibody targeting JAM3 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n86960-1-RR targets JAM3 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, SK-N-SH cells,  A375 cells,  Jurkat cells,  HEK-293 cells,  human heart tissue,  mouse heart tissue\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nJunctional adhesion molecule 3 (JAM3) is a type I transmembrane glycoprotein containing two Ig-like domains, which is expressed in various tissues and plays a crucial role in cell junctions, cell polarity, and motility (PMID: 34292449; 28931565). It has been proposed that JAM3 participates in leukocyte-platelet interactions, as well as angiogenesis and brain development (PMID: 12208882; 23255084). JAM3 may also be a new marker for predicting the prognosis and immune functions of bladder cancer patients (PMID: 38400838).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg6611 Product name: Recombinant Human JAM3 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 32-241 aa of NM_032801.5 Sequence: VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN Predict reactive species\nFull Name: junctional adhesion molecule 3\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: NM_032801.5\nGene Symbol: JAM3\nGene ID (NCBI): 83700\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BX67-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888432205993,"sku":"86960-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86960-1-rr","provider":"Iright","version":"1.0","type":"link"}