Proteintech, 86968-1-RR, Syntenin-1 Recombinant monoclonal antibody

Size: 20ul / 100ul The Syntenin-1 (86968-1-RR) by Proteintech is a Recombinant antibody targeting Syntenin-1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 86968-1-RR targets Syntenin-1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, A549 cells, U2OS cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Syntenin-1, also known as SDCBP (syndecan binding protein) and MDA-9 (melanoma differentiation-associated protein 9), was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is a PDZ-domain-containing molecule that has many interaction partners, and regulates transmembrane-receptor trafficking, cell adhesion, tumor-cell metastasis and neuronal-synapse function. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18078 Product name: Recombinant human SDCBP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 12-139 aa of BC113674 Sequence: VDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQ Predict reactive species Full Name: syndecan binding protein (syntenin) Calculated Molecular Weight: 298 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC113674 Gene Symbol: Syntenin-1 Gene ID (NCBI): 6386 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00560 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.