{"product_id":"proteintech-86972-1-rr","title":"Proteintech, 86972-1-RR, TIP30 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TIP30 (86972-1-RR) by Proteintech is a Recombinant antibody targeting TIP30 in WB, ELISA applications with reactivity to human samples\n86972-1-RR targets TIP30 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A431 cells,  A549 cells,  SW 1990 cells,  A-673 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTIP30, namely HTATIP2 or CC3, was firstly discovered in small cell lung carcinoma, using differential analyses between highly metastatic human variant cells and less metastatic classic cells.TIP30 was found to be downregulated in various tumors and is considered to be a tumor suppressor due to its pro-apoptotic activity and its anti-metastatic and anti-angiogenic capacities.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0353 Product name: Recombinant human TIP30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-276 aa of BC002439 Sequence: TLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP Predict reactive species\nFull Name: HIV-1 Tat interactive protein 2, 30kDa\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 28 kDa, 32 kDa\nGenBank Accession Number: BC002439\nGene Symbol: TIP30\nGene ID (NCBI): 10553\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BUP3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888832401577,"sku":"86972-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86972-1-rr","provider":"Iright","version":"1.0","type":"link"}