{"product_id":"proteintech-87013-1-rr","title":"Proteintech, 87013-1-RR, PSMB9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PSMB9 (87013-1-RR) by Proteintech is a Recombinant antibody targeting PSMB9 in WB, ELISA applications with reactivity to human, mouse, rat samples\n87013-1-RR targets PSMB9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, Ramos cells,  Daudi cells,  Raji cells,  mouse spleen tissue,  rat spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMB9, also named as LMP2, PSMB6i and RING12, belongs to the peptidase T1B family. The proteasome is  an  essential  component of the cellular protein degradation  machinery . It  can be  isolated as a 20 S particle  containing more than 15 different  subunits ranging in molecular masses from 20-35 kDa. The proteasome can also be isolated as  part of a  higher  molecular  mass particle of  26 S which has been  shown to rapidly  degrade both  ubiquitinated and  nonubiquitinated  proteins  in a ATP-dependent fashion. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. High expression of PSMB9 associated with the poor prognosis of patients with NPC. (PMID: 1429565)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6048 Product name: Recombinant human PSMB9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-219 aa of BC065513 Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE Predict reactive species\nFull Name: proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 20-23 kDa\nGenBank Accession Number: BC065513\nGene Symbol: PSMB9\nGene ID (NCBI): 5698\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P28065\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888811233449,"sku":"87013-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-87013-1-rr","provider":"Iright","version":"1.0","type":"link"}