Proteintech, 87035-1-RR, SMAD3 Recombinant monoclonal antibody

Size: 20ul / 100ul The SMAD3 (87035-1-RR) by Proteintech is a Recombinant antibody targeting SMAD3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 87035-1-RR targets SMAD3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-1080 cells, HeLa cells, HEK-293 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information SMAD3, also named as hMAD 3 or Mad3, is a 425 amino acid protein, which contains one MH1 domain and one MH2 domain. SMAD3 localizes in the nucleus and cytoplasm. SMAD3 plays an essential role in development and maintenance of self-tolerance and is a critical mediator of the TGFB signaling pathway. SMAD3 is involved in TGFB dependent regulation of steroidogenesis and in T-cell response to TGFB. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32623 Product name: Recombinant human SMAD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-260 aa of NM_005902 Sequence: EIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGF Predict reactive species Full Name: SMAD family member 3 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: NM_005902 Gene Symbol: SMAD3 Gene ID (NCBI): 4088 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P84022 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.