{"product_id":"proteintech-87049-1-rr","title":"Proteintech, 87049-1-RR, OTUD6B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe OTUD6B (87049-1-RR) by Proteintech is a Recombinant antibody targeting OTUD6B in WB, IF\/ICC, ELISA applications with reactivity to human samples\n87049-1-RR targets OTUD6B in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HEK-293T cells,  A431 cells,  Raji cells\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOTUD6B, also known as DUBA5, belongs to a DUB subfamily characterized by an ovarian tumor domain (OTU). It's a functional deubiquitinating  enzyme, a class of protease that specifically cleaves ubiquitin linkages. OTUD6B function may be connected to growth and proliferation. It has been reported that OTUD6B could significantly suppress HCC cells migration and metastasis.  The calculated molecular weight of OTUD6B is 34 kDa, 87049-1-RR can detect the band around 34 kDa.(PMID:32323143)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag22044 Product name: Recombinant human OTUD6B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC029760 Sequence: MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGH Predict reactive species\nFull Name: OTU domain containing 6B\nCalculated Molecular Weight: 293 aa, 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC029760\nGene Symbol: OTUD6B\nGene ID (NCBI): 51633\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8N6M0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888794489001,"sku":"87049-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-87049-1-rr","provider":"Iright","version":"1.0","type":"link"}