Proteintech, 87070-3-RR, UBL3 Recombinant monoclonal antibody

Size: 20ul / 100ul The UBL3 (87070-3-RR) by Proteintech is a Recombinant antibody targeting UBL3 in WB, ELISA applications with reactivity to human samples 87070-3-RR targets UBL3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells, U-87 MG cells, mouse kidney tissue, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Ubiquitin-like 3 (UBL3)/membrane-anchored Ub-fold protein (MUB) acts as a post-translational modification (PTM) factor to regulate efficient protein sorting to sEVs (small extracellular vesicles). (PMID: 31363817, PMID: 30258067). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5932 Product name: Recombinant human UBL3 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1-117 aa of NM_007106.3 Sequence: MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL Predict reactive species Full Name: ubiquitin-like 3 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: NM_007106.3 Gene Symbol: UBL3 Gene ID (NCBI): 5412 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95164 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.