{"product_id":"proteintech-87094-1-rr","title":"Proteintech, 87094-1-RR, IL-17B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IL-17B (87094-1-RR) by Proteintech is a Recombinant antibody targeting IL-17B in WB, ELISA applications with reactivity to mouse samples\n87094-1-RR targets IL-17B in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein, Transfected with Mouse Il17b Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe interleukin (IL)-17 superfamily, a relatively new family of cytokines, consists of six ligands (from IL-17A to IL-17F), which bind to five receptor subtypes (from IL-17RA to IL-17RE) and induce downstream signaling. IL-17B was originally described as increased during intestinal inflammation. Moreover, it stimulates TNF-α and IL-1β production by the human monocytic leukemia THP-1 cells and promotes neutrophil migration upon intraperitoneal administration, suggesting a pro-inflammatory role. More recent findings strongly suggest a role for the IL-17B\/IL-17RB pathway in tumorigenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2785 Product name: recombinant mouse Il17b protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-180 aa of NM_019508.1 Sequence: RNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF Predict reactive species\nFull Name: interleukin 17B\nCalculated Molecular Weight: 20 kDa\nGenBank Accession Number: NM_019508.1\nGene Symbol: Il17b\nGene ID (NCBI): 56069\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9QXT6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888768176297,"sku":"87094-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-87094-1-rr","provider":"Iright","version":"1.0","type":"link"}