Proteintech, 87106-3-RR, TJAP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The TJAP1 (87106-3-RR) by Proteintech is a Recombinant antibody targeting TJAP1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 87106-3-RR targets TJAP1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, MDA-MB-231 cells, HSC-T6 cells, 4T1 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information TJAP1, also named as PILT and TJP4, is colocalized at the tight junctions. TJAP1 has some forms with MW 60 kDa (native) and 86-90 kDa (modified). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12174 Product name: Recombinant human TJAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC064401 Sequence: MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENEELRRRLASATRRTEALERELEIGQDCLELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLIKKAEMDRKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQSGSAGRPLAEDVFVHVDMSEGVPGDPASPPAPGSPTPQPNGECHSLGTARGSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISLS Predict reactive species Full Name: tight junction associated protein 1 (peripheral) Calculated Molecular Weight: 547 aa, 61 kDa Observed Molecular Weight: 86-90 kDa GenBank Accession Number: BC064401 Gene Symbol: TJAP1 Gene ID (NCBI): 93643 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5JTD0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.