Proteintech, 87122-1-RR, USP3 Recombinant monoclonal antibody

Size: 20ul / 100ul The USP3 (87122-1-RR) by Proteintech is a Recombinant antibody targeting USP3 in WB, ELISA applications with reactivity to human, mouse, rat samples 87122-1-RR targets USP3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information USP3(Ubiquitin carboxyl-terminal hydrolase 3) belongs to the peptidase C19 family. It may regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. USP3 is implicated as a novel chromatin modifier in the maintenance of genome integrity. This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14594 Product name: Recombinant human USP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-300 aa of BC018113 Sequence: MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK Predict reactive species Full Name: ubiquitin specific peptidase 3 Calculated Molecular Weight: 520 aa, 59 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC018113 Gene Symbol: USP3 Gene ID (NCBI): 9960 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y6I4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.