{"product_id":"proteintech-87144-1-rr","title":"Proteintech, 87144-1-RR, CLEC2L Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CLEC2L (87144-1-RR) by Proteintech is a Recombinant antibody targeting CLEC2L in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n87144-1-RR targets CLEC2L in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse cerebellum tissue, rat cerebellum tissue,  mouse brain tissue,  rat brain tissue,  pig cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC-type lectin domain family 2 member L (CLEC2L) is a membrane protein mainly expressed in brain tissue and probably has carbohydrate-binding activity. The CLEC2L-encoded C-type lectin-like receptors (CTLRs) are expressed as non-glycosylated, disulfide-linked homodimers at the cell surface, and designated as BACL (brain-associated C-type lectin) (PMID: 23776472). The CLEC2L protein has 214 amino acids with a predicted molecular mass of 23.9 kDa. Under non-reducing conditions, FLAG-tagged CLEC2L proteins appeared with a molecular mass of ~55 kDa in immunoblots because of the occurrence of disulfide-linked homodimers (PMID: 23776472).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35450 Product name: Recombinant human CLEC2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-214 aa of NM_001080511.2 Sequence: SKGCIKCEAPCPEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQSQKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFTIAGPGECVFVEPTRLVSTECLMTRPWVCSKMAYT Predict reactive species\nFull Name: C-type lectin domain family 2, member L\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: NM_001080511.2\nGene Symbol: CLEC2L\nGene ID (NCBI): 154790\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P0C7M8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888606433449,"sku":"87144-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-87144-1-rr","provider":"Iright","version":"1.0","type":"link"}