Proteintech, 87282-1-RR, UBE2O Recombinant monoclonal antibody

Size: 20ul / 100ul The UBE2O (87282-1-RR) by Proteintech is a Recombinant antibody targeting UBE2O in WB, ELISA applications with reactivity to human, mouse, rat samples 87282-1-RR targets UBE2O in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat brain tissue, Jurkat cells, HCT 116 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information UBE2O, also named as KIAA1734, belongs to the ubiquitin-conjugating enzyme family. It catalyzes the covalent attachment of ubiquitin to other proteins. UBE2O has a calculated molecular mass of 141 kDa, and many bands can be detected as 140-170 kDa and 200-230 kDa (PMID: 28774900, 23455153, 28774922, 11311559). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8580 Product name: Recombinant human UBE2O protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-343 aa of BC007822 Sequence: SSDSGPEAGSQRLLFSHDLVSGRYRGSVHFGLVRLIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGRASPLRRGYVRVQWYPEGVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGAKLYDVCPHVSDSGLFFDDSYGFYPGQVLIGPAKIFSSVQWLSGVKPVLSTKSKFRVVVEEVQVVELKVTWITKSFCPGGTDSVSPPPSVITQENLGRVKRLGCFDHAQRQLGERCLYVFPAKVEPAKIAWECPEKNCAQGEGSMAKKVKRL Predict reactive species Full Name: ubiquitin-conjugating enzyme E2O Calculated Molecular Weight: 1292 aa, 141 kDa Observed Molecular Weight: 200 kDa GenBank Accession Number: BC007822 Gene Symbol: UBE2O Gene ID (NCBI): 63893 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9C0C9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.