{"product_id":"proteintech-87307-1-rr","title":"Proteintech, 87307-1-RR, HEY1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HEY1 (87307-1-RR) by Proteintech is a Recombinant antibody targeting HEY1 in WB, ELISA applications with reactivity to human samples\n87307-1-RR targets HEY1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HCT 116 cells,  143B cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHairy\/enhancer of split-related proteins are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. And HEY1 is one of such protein. It is the direct downstream effector of Notch signaling which may be required for cardiovascular development. It preferentially bind to the canonical E box sequence 5'-CACGTG-3' and acts as a transcriptional repressor. HEY1 is a 33kDa protein and forms dimer by self-associating.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14094 Product name: Recombinant human HEY1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 155-295 aa of BC001873 Sequence: VSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYR Predict reactive species\nFull Name: hairy\/enhancer-of-split related with YRPW motif 1\nCalculated Molecular Weight: 304 aa, 33 kDa\nObserved Molecular Weight: 32-34 kDa\nGenBank Accession Number: BC001873\nGene Symbol: HEY1\nGene ID (NCBI): 23462\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y5J3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888761295017,"sku":"87307-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-87307-1-rr","provider":"Iright","version":"1.0","type":"link"}