{"product_id":"proteintech-87319-1-rr","title":"Proteintech, 87319-1-RR, UBC9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe UBC9 (87319-1-RR) by Proteintech is a Recombinant antibody targeting UBC9 in WB, ELISA applications with reactivity to human, mouse, rat samples\n87319-1-RR targets UBC9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cellls,  Jurkat cellls,  NIH\/3T3 cellls,  PC-12 cellls,  mouse testis tissue,  rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBC9 is also named as UBE2I, UBCE9 and belongs to the ubiquitin-conjugating enzyme family. It is a homologue of the E2 ubiquitin conjugating enzyme and participates in the covalent linking of SUMO-1 molecule to the target protein. This protein is present at a high level in spleen and lung. Moderate level of UBC9 is detected in kidney and liver.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0111 Product name: Recombinant human UBC9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC004437 Sequence: VPGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYWLVAALAPLVAAPPRPSQGRLAGREWSTQAHPRDSQGPRLC Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast)\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC004437\nGene Symbol: UBC9\nGene ID (NCBI): 7329\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P63279\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888838398121,"sku":"87319-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-87319-1-rr","provider":"Iright","version":"1.0","type":"link"}